PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16941-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 674aa    MW: 73884 Da    PI: 7.1257
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16941-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.91.3e-163589256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     r+ +++t++q+++Le +F  + +p++++r  +++++gLt +qVk+WFqN+R+ +k
  TRIUR3_16941-P1 35 RRLQRLTPQQTQVLEGFFGICAHPDENQRMGMSESTGLTMQQVKFWFQNKRTHMK 89
                     666899**********************************************998 PP

2START93.44.4e-301884031203
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....... CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....... 77 
                      ela++a+ e+v +a+a+ p+W+ ++    + +n++ + q+f    +      + +ea ra  +v m++ + v  ++d+  +++  ++       
  TRIUR3_16941-P1 188 ELAQSAMHEFVVLAEAGGPLWMPVPggsfDVLNKMAYAQTFGARSSanvilgFMTEATRADDMVMMDAKQIVDYIMDSE-CYTSFCTglltsan 280
                      57999************************************66555899***9****************9999999999.99999999999666 PP

                      EEEEEEEECTT...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
            START  78 kaetlevissg...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                        ++++  +s+   ga +l + e++++splvp R+ +fvR++r ++ g+ +ivdvS+d+ +        v++++ pSg l++++    s+vt++
  TRIUR3_16941-P1 281 TTKIYKWPTSAgynGAMHLVTVETVFPSPLVPsRKCTFVRCCRDMQNGTVIIVDVSLDNGDGT------VKCHKMPSGVLVRSLNSDASQVTVI 368
                      666666677769**********************************************99984......79*********************** PP

                      E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
            START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrq 203
                      ehv +++   h+l+r+ + sgl++ga++wv+   rq
  TRIUR3_16941-P1 369 EHVQVNDTGLHELYRPSL-SGLMFGARRWVSSIVRQ 403
                      ****************98.699********876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-171985IPR009057Homeodomain-like
SuperFamilySSF466893.43E-162791IPR009057Homeodomain-like
PROSITE profilePS5007114.8033191IPR001356Homeobox domain
SMARTSM003891.0E-133395IPR001356Homeobox domain
CDDcd000861.51E-143490No hitNo description
PfamPF000463.2E-143589IPR001356Homeobox domain
PROSITE patternPS0002706689IPR017970Homeobox, conserved site
CDDcd146860.00255137158No hitNo description
PROSITE profilePS5084820.364179409IPR002913START domain
SuperFamilySSF559614.4E-16184403No hitNo description
CDDcd088752.96E-68186405No hitNo description
SMARTSM002343.6E-8188406IPR002913START domain
PfamPF018521.4E-22188400IPR002913START domain
Gene3DG3DSA:3.30.530.207.0E-4254373IPR023393START-like domain
SuperFamilySSF559613.43E-10447627No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MPQPQQDRPA RDNDLDISQG NSDGQDGAEG SQPKRRLQRL TPQQTQVLEG FFGICAHPDE  60
NQRMGMSEST GLTMQQVKFW FQNKRTHMKH VTGKEETYRM KAQNEMLREE NKRLASAAKT  120
SFCPSCVALP GLSPSGEVQR LRQENEQLKQ QLSQLRAEAH PSSSRPFQLD PSMENITGRE  180
NDMDAIAELA QSAMHEFVVL AEAGGPLWMP VPGGSFDVLN KMAYAQTFGA RSSANVILGF  240
MTEATRADDM VMMDAKQIVD YIMDSECYTS FCTGLLTSAN TTKIYKWPTS AGYNGAMHLV  300
TVETVFPSPL VPSRKCTFVR CCRDMQNGTV IIVDVSLDNG DGTVKCHKMP SGVLVRSLNS  360
DASQVTVIEH VQVNDTGLHE LYRPSLSGLM FGARRWVSSI VRQSARMRDL FVVSKSASNG  420
NTNGRKTLMK IADGLLAGYA SGIAAVPGGG WTILRGAGTE DDIRISYRRN NDDSNTAIVS  480
VCASFHLPVP HRVTFDLLKN NLLRPKWDVL VNGNSVREEV AVCKGVGGGI DDVVSILHLK  540
DPPTGENRDN IMILQNSSYD VSGAFMVYCP VNIQLMNEIM SPSDTAESNK VSLYPTGFYL  600
LPVEDTALGL GEGGATLVTV GFQIMLKLAR GTGLYPRSAS TAVGLMTENI GTIKKTLTSS  660
HPIFYRRQPP NNFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF3320360.0JF332036.1 Triticum turgidum subsp. durum HD-Zip IV transcription factor GL9H2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLM7YX170.0M7YX17_TRIUA; Homeobox-leucine zipper protein TF1
STRINGMLOC_13375.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-100protodermal factor 2